PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI09G13610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 194aa    MW: 21001.7 Da    PI: 10.8857
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI09G13610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_157.72.5e-18124177457
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                      ++r rr++kNRe+A rsR+RK+a++ +Le++v++L++eNk+L+ + e+l+k+v+
  OMERI09G13610.1 124 DRRKRRMIKNRESAARSRARKQARVNNLETEVEQLKQENKMLRVKYEQLRKTVE 177
                      789************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-12121188IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.7E-17123177No hitNo description
PROSITE profilePS5021712.093123177IPR004827Basic-leucine zipper domain
PfamPF001702.4E-16124177IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.38E-13125177No hitNo description
CDDcd147073.17E-19125175No hitNo description
PROSITE patternPS000360128143IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MAMEDDEDMW ANTSSPSASP PRPRGFISTA LSLNSTHLQG LLPSSFVDAA AASPCHASGN  60
NSGGGDGRNA APMSSFFSAS ASYHQQQQHH LPAPAPLDGA ILPARRFGLD MCAAAAAGVP  120
AAGDRRKRRM IKNRESAARS RARKQARVNN LETEVEQLKQ ENKMLRVKYE QLRKTVEVPV  180
PVRRTLQRVL SAPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8359080.0CT835908.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN083I14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611345.11e-103PREDICTED: uncharacterized protein LOC9271661
TrEMBLA0A0E0EUF01e-142A0A0E0EUF0_9ORYZ; Uncharacterized protein
STRINGLOC_Os09g36910.11e-102(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17770.24e-09basic region/leucine zipper motif 27